PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.127860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 223aa    MW: 25461.5 Da    PI: 8.5968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.127860.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-141865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
   Cucsa.127860.1 18 KGLWSPDEDEKLMRYMLSNGQGCWTDIARNAGLLRCGKSCRLRWINYL 65
                     678*****************************99************97 PP

2Myb_DNA-binding50.44.9e-1671115147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+++ + +lG++ W+ Ia++++ gRt++++k++w++ 
   Cucsa.127860.1  71 RGAFSPQEEQLILHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNST 115
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1471365IPR017930Myb domain
SuperFamilySSF466895.5E-2815112IPR009057Homeodomain-like
SMARTSM007176.7E-111767IPR001005SANT/Myb domain
PfamPF002492.3E-131865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-211972IPR009057Homeodomain-like
CDDcd001672.90E-92165No hitNo description
PROSITE profilePS5129424.97366120IPR017930Myb domain
SMARTSM007171.4E-1570118IPR001005SANT/Myb domain
PfamPF002494.1E-1571115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2673121IPR009057Homeodomain-like
CDDcd001671.88E-1173116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MRKPGDCSTA AANIRLRKGL WSPDEDEKLM RYMLSNGQGC WTDIARNAGL LRCGKSCRLR  60
WINYLRPDLK RGAFSPQEEQ LILHFHSLLG NRWSQIAARL PGRTDNEIKN FWNSTLKKRM  120
KNNRNYNITP SPNLSHSSEP RSSNNSFGEQ PSSFEPLLFS TLSNDNYQLF NMFDDGGSGG  180
GVTEQGYFGD YTTTTILEAK DFYDYSHLPP HGNKDIIIEE INK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28161205108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818041e-133LN681804.1 Cucumis melo genomic scaffold, anchoredscaffold00060.
GenBankLN7132551e-133LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136117.11e-163PREDICTED: transcription factor MYB46
SwissprotQ9LXV29e-68MYB46_ARATH; Transcription factor MYB46
TrEMBLM5XMW68e-75M5XMW6_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g02110.t011e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-69myb domain protein 83